PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna13281.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family MYB
Protein Properties Length: 291aa    MW: 33002.7 Da    PI: 7.2106
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna13281.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.45.1e-161764148
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                             +g W++eEd++l +++ ++G g+W++++   g+ R +k+c++rw +yl
  mrna13281.1-v1.0-hybrid 17 KGLWSPEEDQRLRNYIIKHGHGCWSSVPINAGLQRNGKSCRLRWINYL 64
                             678*******************************************97 PP

2Myb_DNA-binding48.81.6e-1570115148
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                              rg ++++E+e +++++ +lG++ W+ Ia++++ gRt++++k++w++yl
  mrna13281.1-v1.0-hybrid  70 RGIFSKQEEETILNLHCMLGNK-WSQIAQHLP-GRTDNEIKNFWHSYL 115
                              6789******************.*********.************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129425.2241268IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.8E-211267IPR009057Homeodomain-like
SuperFamilySSF466891.65E-2814111IPR009057Homeodomain-like
SMARTSM007171.2E-111666IPR001005SANT/Myb domain
PfamPF002492.7E-141764IPR001005SANT/Myb domain
CDDcd001676.86E-112064No hitNo description
Gene3DG3DSA:1.10.10.601.2E-2468119IPR009057Homeodomain-like
SMARTSM007171.2E-1369117IPR001005SANT/Myb domain
PROSITE profilePS5129419.6269119IPR017930Myb domain
PfamPF002494.5E-1470115IPR001005SANT/Myb domain
CDDcd001672.45E-1073115No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009751Biological Processresponse to salicylic acid
GO:0010018Biological Processfar-red light signaling pathway
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 291 aa     Download sequence    Send to blast
MGCKSSDSPK PKPKHRKGLW SPEEDQRLRN YIIKHGHGCW SSVPINAGLQ RNGKSCRLRW  60
INYLRPGLKR GIFSKQEEET ILNLHCMLGN KWSQIAQHLP GRTDNEIKNF WHSYLKKKVA  120
KADEDQDQME LAQSKSQYTS TSSSDHNLDQ HSPCSEKLTS TQIPSYNESP TLAPQIDNQS  180
QRPSPLPRVL FAEWLSLDHV QGGSIGNNIG IDQHNYNPRA DHGLGQSYTY NNEATFGTSG  240
FHHGPSTRDI MNSEFRYDPQ DLIPGTGFVD FIYEGDLVTD FTLHNDVMYM *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-22131193108B-MYB
1h8a_C1e-221311923128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004309212.10.0PREDICTED: transcription factor LAF1
SwissprotQ9M0K44e-61LAF1_ARATH; Transcription factor LAF1
TrEMBLM5XTG91e-126M5XTG9_PRUPE; Uncharacterized protein
STRINGVIT_16s0050g00050.t011e-93(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF38303161
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G25560.16e-61myb domain protein 18